Recombinant Human Cancer/testis antigen family 45 member A7 (CT457)

Catalog Number: BYT-ORB3009156
Article Name: Recombinant Human Cancer/testis antigen family 45 member A7 (CT457)
Biozol Catalog Number: BYT-ORB3009156
Supplier Catalog Number: orb3009156
Alternative Catalog Number: BYT-ORB3009156-1, BYT-ORB3009156-100, BYT-ORB3009156-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cancer/testis antigen family 45 member A7, Cancer/testis antigen 45A7, CT45A7
This Recombinant Human Cancer/testis antigen family 45 member A7 (CT457) spans the amino acid sequence from region 1-189. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DMV0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFSKDGMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
Application Notes: Biological Origin: Homo sapiens (Human)