Recombinant Human Cancer/testis antigen family 45 member A10 (CT45A)

Catalog Number: BYT-ORB3009157
Article Name: Recombinant Human Cancer/testis antigen family 45 member A10 (CT45A)
Biozol Catalog Number: BYT-ORB3009157
Supplier Catalog Number: orb3009157
Alternative Catalog Number: BYT-ORB3009157-1, BYT-ORB3009157-100, BYT-ORB3009157-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cancer/testis antigen family 45 member A10, Cancer/testis antigen 45A10, CT45A10
This Recombinant Human Cancer/testis antigen family 45 member A10 (CT45A) spans the amino acid sequence from region 1-189. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DMU9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFSKDGMMQKPGSNAPVGGNVTSNFSGDDLECRGIASSPKSQQEINADIKCQVVKEIRCLGRKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
Application Notes: Biological Origin: Homo sapiens (Human)