Recombinant Human Cancer/testis antigen family 45 member A6 (CT456)

Catalog Number: BYT-ORB3009159
Article Name: Recombinant Human Cancer/testis antigen family 45 member A6 (CT456)
Biozol Catalog Number: BYT-ORB3009159
Supplier Catalog Number: orb3009159
Alternative Catalog Number: BYT-ORB3009159-1, BYT-ORB3009159-100, BYT-ORB3009159-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cancer/testis antigen family 45 member A6, Cancer/testis antigen 45-6, Cancer/testis antigen 45A6, CT45A6 CT45-6
This Recombinant Human Cancer/testis antigen family 45 member A6 (CT456) spans the amino acid sequence from region 1-189. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DMU7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFSKDGMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
Application Notes: Biological Origin: Homo sapiens (Human)