Recombinant Human Proline-rich protein 23D2 (P23D2)

Product Overview

• Article Name: Recombinant Human Proline-rich protein 23D2 (P23D2)
• Biozol Catalog Number: BYT-ORB3009167
• Supplier Catalog Number: orb3009167
• Alternative Catalog Number: BYT-ORB3009167-1, BYT-ORB3009167-100, BYT-ORB3009167-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Proline-rich protein 23D2 PRR23D2

Product Description

This Recombinant Human Proline-rich protein 23D2 (P23D2) spans the amino acid sequence from region 1-279. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P0DMB1
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MYGYRRLRSPRDSQTEPQNDNEGETSLATTQMNPPKRRQVEQGPSTGAKKPSISGAPHLNSYQSLELPQNQQDSGTEELMIVLEQGTEVRLSLEEVILILAPETVLQLTLENTVLVIVPEHVLRSEDGLQSPVQIQYIIPSVDDFSLEFHAQDGDISDMRRENVPFSPAEEGKAAPLYQQPLMIPQANHMAGISPSFLVTPLCIPRCRAAFPQCYPLPPTPSPVGRPRPADSSFSLHGMELLCTSSLRPMPPSPS

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)