Recombinant Human Small integral membrane protein 17 (SIM17), partial

Catalog Number: BYT-ORB3009168
Article Name: Recombinant Human Small integral membrane protein 17 (SIM17), partial
Biozol Catalog Number: BYT-ORB3009168
Supplier Catalog Number: orb3009168
Alternative Catalog Number: BYT-ORB3009168-1, BYT-ORB3009168-100, BYT-ORB3009168-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Small integral membrane protein 17 SMIM17
This Recombinant Human Small integral membrane protein 17 (SIM17), partial spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DL12
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MQSLRPEQTRGLLEPERTKTLLPRESRAWEKPPHPACTKDWEAVEVGASSHDSDEKDLSSQETGLSQEWSSVEEDDESEGSQGFVEWSKAPQQTT
Application Notes: Biological Origin: Homo sapiens (Human)