Recombinant Human Small integral membrane protein 18 (SIM18), partial

Catalog Number: BYT-ORB3009169
Article Name: Recombinant Human Small integral membrane protein 18 (SIM18), partial
Biozol Catalog Number: BYT-ORB3009169
Supplier Catalog Number: orb3009169
Alternative Catalog Number: BYT-ORB3009169-1, BYT-ORB3009169-100, BYT-ORB3009169-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Small integral membrane protein 18 SMIM18
This Recombinant Human Small integral membrane protein 18 (SIM18), partial spans the amino acid sequence from region 56-95. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DKX4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YEVLDCCCCVKNKTVKDLKSEPNPLRSMMDNIRKRETEVV
Application Notes: Biological Origin: Homo sapiens (Human)