Recombinant Human Zinc finger protein 728 (ZN728)

Product Overview

• Article Name: Recombinant Human Zinc finger protein 728 (ZN728)
• Biozol Catalog Number: BYT-ORB3009170
• Supplier Catalog Number: orb3009170
• Alternative Catalog Number: BYT-ORB3009170-1, BYT-ORB3009170-100, BYT-ORB3009170-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Zinc finger protein 728 ZNF728

Product Description

This Recombinant Human Zinc finger protein 728 (ZN728) spans the amino acid sequence from region 1-622. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P0DKX0
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MGSLTFRDVAIQFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAAPKPDLIIFLEQGKEPWNMKRHELVKEPPVICSHFAQDLWPEQGREDSFQKVILRRYEKCGHENLQLKIGCTNVDECKVHKKGYNKLNQSLTTTQSKVFQCGKYANIFHKCSNSKRHKIRHTGKKLLKCKEYVRSFCMLSHLSQHKRIYTRENSYKSEEHGKAFNWSSALTYKRIHTGEKPCKCEECGKAFSKFSILTKHKVIHTGEKH

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)