Recombinant Human Golgin subfamily A member 8T (GOG8T)

Catalog Number: BYT-ORB3009188
Article Name: Recombinant Human Golgin subfamily A member 8T (GOG8T)
Biozol Catalog Number: BYT-ORB3009188
Supplier Catalog Number: orb3009188
Alternative Catalog Number: BYT-ORB3009188-1, BYT-ORB3009188-100, BYT-ORB3009188-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Golgin subfamily A member 8T GOLGA8T
This Recombinant Human Golgin subfamily A member 8T (GOG8T) spans the amino acid sequence from region 1-631. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: H3BQL2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAEETQHNKLAAAKKKLKEYWQKNSPRVPAGANRNRKTNGSIPEKATSGGCQPPRDSATGFHREGPTSSATLKDLESPCQERAVVLDSRSVEISQLKNTIKSLKQQKKQVEHQLEEEKKANNKKQKAKRVLEVQIQTLNIQKEELNTDLYHMKRSLRYFEEKSKDLAVRLQHSLQRKGELESVLSNVMATQKKKANQLSSRSKARTEWKLEQSMREETLLKVQLTQLKESFQQVQLERDEYSEHLKGERARWQQR
Application Notes: Biological Origin: Homo sapiens (Human)