Recombinant Human Lymphocyte antigen 6L (LY6L)

Catalog Number: BYT-ORB3009189
Article Name: Recombinant Human Lymphocyte antigen 6L (LY6L)
Biozol Catalog Number: BYT-ORB3009189
Supplier Catalog Number: orb3009189
Alternative Catalog Number: BYT-ORB3009189-1, BYT-ORB3009189-100, BYT-ORB3009189-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Lymphocyte antigen 6L, Lymphocyte antigen 6 complex locus protein L, LY6L
This Recombinant Human Lymphocyte antigen 6L (LY6L) spans the amino acid sequence from region 17-117. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: H3BQJ8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SAGCATTPARNLSCYQCFKVSSWTECPPTWCSPLDQVCISNEVVVSFKWSVRVLLSKRCAPRCPNDNMKFEWSPAPMVQGVITRRCCSWALCNRALTPQEG
Application Notes: Biological Origin: Homo sapiens (Human)