Recombinant Human Putative golgin subfamily A member 6-like protein 19 (GG6LS)

Catalog Number: BYT-ORB3009193
Article Name: Recombinant Human Putative golgin subfamily A member 6-like protein 19 (GG6LS)
Biozol Catalog Number: BYT-ORB3009193
Supplier Catalog Number: orb3009193
Alternative Catalog Number: BYT-ORB3009193-1, BYT-ORB3009193-100, BYT-ORB3009193-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Putative golgin subfamily A member 6-like protein 19 GOLGA6L19
This Recombinant Human Putative golgin subfamily A member 6-like protein 19 (GG6LS) spans the amino acid sequence from region 1-550. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: H0YKK7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MWPQPRLPPHPAMSEKTQQGKLAAAKKKLKAYWQRKSPGIPAGANRKKKVNGSSPDTATSGGYHSPGDSATGVYGEGRASSTTLQDLESQYQELAVALDSSSAIISQLTENINSLVRTSKEEKKHEIHLVQKLGRSLFKLKNQTAEPLAPEPPAGPSKVEQLQDETNHLRKELESVGRQLQAEVENNQMLSLLNRRQEERLREQEERLHEQEERLHEQEERLCEQEERLREQEERLCEQEERLREQEERLCEQEE
Application Notes: Biological Origin: Homo sapiens (Human)