Recombinant Human PRAME family member 26 (PRA26)

Catalog Number: BYT-ORB3009194
Article Name: Recombinant Human PRAME family member 26 (PRA26)
Biozol Catalog Number: BYT-ORB3009194
Supplier Catalog Number: orb3009194
Alternative Catalog Number: BYT-ORB3009194-1, BYT-ORB3009194-100, BYT-ORB3009194-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: PRAME family member 26 PRAMEF26
This Recombinant Human PRAME family member 26 (PRA26) spans the amino acid sequence from region 1-478. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: H0Y7S4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKMSIRTPPRLLELAGRSVLRDQALAMSTLEELPTELFPPLFMEAFSRRRCEALKLMVQAWPFRRLPLRPLIKMPCLETFQAVLNGLDALLTHGVRPRRWKLQVLDLQDVCENFWMVWSEAMARGCFLNAKRNKKPVQDCPRMRGRQPLTVFVELWLKNRTLDEHLTCLLLWVKQRKDLLHLCCKKLKILGMPFRNIRSILKMVNLDCIQEVEVNCKWVLPILTQFTPYLGHMRNLQKLVLSHMDVSRYVSPEQK
Application Notes: Biological Origin: Homo sapiens (Human)