Recombinant Human Protein FAM72C (FA72C)

Catalog Number: BYT-ORB3009195
Article Name: Recombinant Human Protein FAM72C (FA72C)
Biozol Catalog Number: BYT-ORB3009195
Supplier Catalog Number: orb3009195
Alternative Catalog Number: BYT-ORB3009195-1, BYT-ORB3009195-100, BYT-ORB3009195-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Protein FAM72C FAM72C
This Recombinant Human Protein FAM72C (FA72C) spans the amino acid sequence from region 1-149. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: H0Y354
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVVYHVIVPCSSCLLSCNNRHFWMFHSQAVYDINRLDSTGVNVLLRGNLPEIEESTDEDVLNISAEECIR
Application Notes: Biological Origin: Homo sapiens (Human)