Recombinant Human Ankyrin repeat domain-containing protein 66 (ANR66)

Catalog Number: BYT-ORB3009226
Article Name: Recombinant Human Ankyrin repeat domain-containing protein 66 (ANR66)
Biozol Catalog Number: BYT-ORB3009226
Supplier Catalog Number: orb3009226
Alternative Catalog Number: BYT-ORB3009226-1, BYT-ORB3009226-100, BYT-ORB3009226-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Ankyrin repeat domain-containing protein 66 ANKRD66
This Recombinant Human Ankyrin repeat domain-containing protein 66 (ANR66) spans the amino acid sequence from region 1-196. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: B4E2M5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MELAKMSDMTKLHQAVAAGDYSLVKKILKKGLCDPNYKDVDWNDRTPLHWAAIKGQMEVIRLLIEYGARPCLVTSVGWTPAHFAAEAGHLNILKTLHALHAAIDAPDFFGDTPKRIAQIYGQKACVAFLEKAEPECQDHRCAAQQKGLPLDERDEDWDAKKRELELSLPSLNQNMNKKNKKSRGPTRPSNTKGRRV
Application Notes: Biological Origin: Homo sapiens (Human)