Recombinant Human PRAME family member 27 (PRA27)

Catalog Number: BYT-ORB3009231
Article Name: Recombinant Human PRAME family member 27 (PRA27)
Biozol Catalog Number: BYT-ORB3009231
Supplier Catalog Number: orb3009231
Alternative Catalog Number: BYT-ORB3009231-1, BYT-ORB3009231-100, BYT-ORB3009231-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: PRAME family member 27 PRAMEF27
This Recombinant Human PRAME family member 27 (PRA27) spans the amino acid sequence from region 1-478. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: A3QJZ7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKMSIRTPPRLLELAGRSLLRDQALAMSTLEELPTELFPPLFMEAFSRRCCEALKLMVQAWPFRRLPLRPLIKMPCLEAFQAVLDGLDALLTQGVCPRRWKLQVLDLQDVCENFWMVWSEAMARGSFLNAKRNKTPVQDCPRMRGQQPLTVFVELWLKNRTLDEYLTYLLLWVKQRKDLLHLCCKKLKILGMPFRNIRSILKMVNLDCIQEVEVNCKWVLPILTQFTPYLGHMRNLQKLVLSHMDVSRYVSPEQK
Application Notes: Biological Origin: Homo sapiens (Human)