REPIN1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324394
Article Name: REPIN1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324394
Supplier Catalog Number: orb324394
Alternative Catalog Number: BYT-ORB324394-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human REPIN1
Conjugation: Unconjugated
Alternative Names: anti AP4 antibody, anti RIP60 antibody, anti ZNF464 antibody, anti Zfp464 antibody
Rabbit polyclonal antibody to REPIN1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 63kDa
NCBI: 037532
UniProt: Q9BWE0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GNCGRSFAQWDQLVAHKRVHVAEALEEAAAKALGPRPRGRPAVTAPRPGG
Target: REPIN1