HCFC2 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324395
Article Name: HCFC2 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324395
Supplier Catalog Number: orb324395
Alternative Catalog Number: BYT-ORB324395-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human HCFC2
Conjugation: Unconjugated
Alternative Names: HCF2, HCF-2
Rabbit polyclonal antibody to HCFC2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 87 kDa
NCBI: 037452
UniProt: Q9Y5Z7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: RIYCGLKTSCIVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQVRW
Target: HCFC2