TBX19 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324416
| Article Name: |
TBX19 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324416 |
| Supplier Catalog Number: |
orb324416 |
| Alternative Catalog Number: |
BYT-ORB324416-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human TBX19 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti FLJ26302 antibody, anti FLJ34543 antibody, anti TBS 19 antibody, anti TBS19 antibody, anti TPIT antibody, anti dJ747L4.1 antibody |
| Rabbit polyclonal antibody to TBX19 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
48kDa |
| NCBI: |
005140 |
| UniProt: |
O60806 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: IKYNPFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCT |
| Target: |
TBX19 |
