SIX4 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324418
Article Name: SIX4 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324418
Supplier Catalog Number: orb324418
Alternative Catalog Number: BYT-ORB324418-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SIX4
Conjugation: Unconjugated
Alternative Names: Anti-SIX4 antibody, anti AREC3 antibody, anti Homeobox protein SIX4 antibody, anti Sine oculis homeobox homolog 4 antibody, anti SIX homeobox 4 antibody
Rabbit polyclonal antibody to SIX4
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 57kDa
NCBI: 059116
UniProt: Q9UIU6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: EKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQVSNWFKNRRQRDRNP
Target: SIX4