ACAT2 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: ACAT2 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324433
• Supplier Catalog Number: orb324433
• Alternative Catalog Number: BYT-ORB324433-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACAT2
• Conjugation: Unconjugated
• Alternative Names: anti DI antibody, anti FR antibody, anti SW antibody, anti WD antibody, anti WR antibody, anti AE1 antibody, anti WD1 antibody, anti BND3 antibody, anti EPB3 antibody, anti CD233 antibody, anti EMPB3 antibody, anti RTA1A antibody, anti ACAT2 antibody

Product Description

Rabbit polyclonal antibody to SLC4A1

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 41kDa
• NCBI: 005882
• UniProt: Q9BWD1
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR
• Target: ACAT2