REXO4 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324442
Article Name: REXO4 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324442
Supplier Catalog Number: orb324442
Alternative Catalog Number: BYT-ORB324442-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human REXO4
Conjugation: Unconjugated
Alternative Names: anti XPMC2 antibody, anti XPMC2H antibody, anti REX4 antibody
Rabbit polyclonal antibody to REXO4
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 47kDa
NCBI: 065118
UniProt: Q9GZR2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: PADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALALDCEM
Target: REXO4