ZFAT1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324444
Article Name: ZFAT1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324444
Supplier Catalog Number: orb324444
Alternative Catalog Number: BYT-ORB324444-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZFAT1
Conjugation: Unconjugated
Alternative Names: anti AITD3 antibody, anti KIAA1485 antibody, anti MGC126815 antibody, anti MGC126817 antibody, anti ZFAT antibody, anti ZNF406 antibody, anti ZFAT1 antibody
Rabbit polyclonal antibody to ZFAT
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 94kDa
NCBI: 001025110
UniProt: Q9P243
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: KHIRDAHDPQDKKVKEALDELCLMTREGKRQLLYDCHICERKFKNELDRD
Target: ZFAT