IVNS1ABP Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324453
Article Name: IVNS1ABP Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324453
Supplier Catalog Number: orb324453
Alternative Catalog Number: BYT-ORB324453-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IVNS1ABP
Conjugation: Unconjugated
Alternative Names: anti ND1 antibody, anti NS-1 antibody, anti NS1BP antibody, anti FLARA3 antibody, anti KLHL39 antibody, anti NS1-BP antibody, anti HSPC068 antibody
Rabbit polyclonal antibody to IVNS1ABP
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 72kDa
NCBI: 006460
UniProt: Q9Y6Y0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK
Target: IVNS1ABP