BBX Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324461
Article Name: BBX Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324461
Supplier Catalog Number: orb324461
Alternative Catalog Number: BYT-ORB324461-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BBX
Conjugation: Unconjugated
Alternative Names: anti HSPC339 antibody, anti MDS001 antibody, anti HBP2 antibody
Rabbit polyclonal antibody to BBX
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 101kDa
NCBI: 064620
UniProt: Q8WY36
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: KKTGNVSSEPTKTSKGSGDKWSNKQLFLDAIHPTEAIFSEDRNTMEPVHK
Target: BBX