HS747E2A Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324575
| Article Name: |
HS747E2A Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324575 |
| Supplier Catalog Number: |
orb324575 |
| Alternative Catalog Number: |
BYT-ORB324575-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human HS747E2A |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti HS747E2A antibody, anti bK747E2.1 antibody |
| Rabbit polyclonal antibody to C22orf31 |
| Clonality: |
Polyclonal |
| Concentration: |
1.0 mg/ml |
| Molecular Weight: |
33kDa |
| NCBI: |
056185 |
| UniProt: |
O95567 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: MKATQQARKRNFISSKSKQPAGHRRPAGGIRESKESSKEKKLTVRQDLED |
| Target: |
C22orf31 |
![]()
|
WB Suggested Anti-HS747E2A Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:500, Positive Control: HepG2 cell lysate. |
