JADE1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324576
Article Name: JADE1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324576
Supplier Catalog Number: orb324576
Alternative Catalog Number: BYT-ORB324576-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human JADE1
Conjugation: Unconjugated
Alternative Names: PHF17
Rabbit polyclonal antibody to PHF15
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 55kDa
NCBI: 001274366
UniProt: Q6IE81
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: DLAEALVDFIYQYWKLKRKANANQPLLTPKTDEVDNLAQQEQDVLYRRLK
Target: JADE1
Sample Type: Liver Tumor lysates, Antibody Dilution: 1.0 ug/mL.