HSF2BP Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324578
Article Name: HSF2BP Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324578
Supplier Catalog Number: orb324578
Alternative Catalog Number: BYT-ORB324578-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSF2BP
Conjugation: Unconjugated
Alternative Names: POF19, MEILB2
Rabbit polyclonal antibody to HSF2BP
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 38kDa
NCBI: 008962
UniProt: O75031
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: EQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCT
Target: HSF2BP
WB Suggested Anti-HSF2BP Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human Lung.