PKDREJ Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324593
| Article Name: |
PKDREJ Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324593 |
| Supplier Catalog Number: |
orb324593 |
| Alternative Catalog Number: |
BYT-ORB324593-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human PKDREJ |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to PKDREJ |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
254kDa |
| NCBI: |
006062 |
| UniProt: |
Q9NTG1 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: GVADNGSVLEITPDVAEVYLVRKNLTFAAFNLTVGPNSEVDGSLKKTTGG |
| Target: |
PKDREJ |
![]()
|
WB Suggested Anti-PKDREJ Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate. |
