Gabrp Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324595
| Article Name: |
Gabrp Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324595 |
| Supplier Catalog Number: |
orb324595 |
| Alternative Catalog Number: |
BYT-ORB324595-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti MGC38123 antibody |
| Rabbit polyclonal antibody to Gabrp |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
50kDa |
| NCBI: |
666129 |
| UniProt: |
Q8QZW7 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: GFENLTAGYNKFLRPNFGGDPVRIALTLDIASISSISESNMDYTATIYLR |
| Target: |
Gabrp |
![]()
|
WB Suggested Anti-Gabrp Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Kidney. |
