KCNIP2 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324609
Article Name: KCNIP2 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324609
Supplier Catalog Number: orb324609
Alternative Catalog Number: BYT-ORB324609-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KCIP2
Conjugation: Unconjugated
Alternative Names: anti KCNIP2 antibody, anti KCHIP2 antibody, anti antibody
Rabbit polyclonal antibody to KCIP2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 29kDa
UniProt: Q9NS61
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: PRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNEC
Target: KCNIP2
Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/mL.