PRDM9 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: PRDM9 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324624
• Supplier Catalog Number: orb324624
• Alternative Catalog Number: BYT-ORB324624-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRDM9
• Conjugation: Unconjugated
• Alternative Names: anti PFM6 antibody, anti MSBP3 antibody, anti PRMD9 antibody, anti ZNF899 antibody, anti MEISETZ antibody

Product Description

Rabbit polyclonal antibody to PRDM9

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 103kDa
• NCBI: 064612
• UniProt: Q9NQV7
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: CPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP
• Target: PRDM9

Images

Anti-PRDM9 antibody IHC staining of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Anti-PRDM9 antibody IHC staining of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: 293T, Antibody Dilution: 1.0 ug/mL.

Sample Type: HepG2, Antibody Dilution: 1.0 ug/mL.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-PRDM9 Antibody, Paraffin Embedded Tissue: Human Placenta, Antibody Concentration: 5 ug/mL.

WB Suggested Anti-PRDM9 Antibody Titration: 1 ug/mL, Positive Control: 293T cells lysate.