SBZF3 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324625
| Article Name: |
SBZF3 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324625 |
| Supplier Catalog Number: |
orb324625 |
| Alternative Catalog Number: |
BYT-ORB324625-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human SBZF3 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti SBZF3 antibody, anti RP11-551G24.1 antibody |
| Rabbit polyclonal antibody to ZNF695 |
| Clonality: |
Polyclonal |
| Concentration: |
1.0 mg/ml |
| Molecular Weight: |
54kDa |
| UniProt: |
Q9HD74 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: FNMQFLFHSLAMSKPELIICLEARKEPWNVNTEKTAKHSALSSYLTEDIL |
| Target: |
ZNF695 |
![]()
|
WB Suggested Anti-SBZF3 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate. |
