ZSCAN5A Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324627
| Article Name: |
ZSCAN5A Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324627 |
| Supplier Catalog Number: |
orb324627 |
| Alternative Catalog Number: |
BYT-ORB324627-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human ZSCAN5A |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti ZNF495 antibody, anti ZSCAN5 antibody |
| Rabbit polyclonal antibody to ZSCAN5A |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
54kDa |
| NCBI: |
077279 |
| UniProt: |
Q9BUG6 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: QDSDIEMAEAPSSVRDDLKDVSSQRASSVNQMRPGEGQAHRELQILPRVP |
| Target: |
ZSCAN5A |
![]()
|
Sample Type: SH-SYSY Whole Cell lysates, Antibody Dilution: 1.0 ug/mL. |
