INTS6L Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324650
| Article Name: |
INTS6L Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324650 |
| Supplier Catalog Number: |
orb324650 |
| Alternative Catalog Number: |
BYT-ORB324650-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human DDX26B |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti DKFZp686G0470 antibody, anti FLJ41215 antibody, anti MGC88298 antibody |
| Rabbit polyclonal antibody to DDX26B |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
97kDa |
| NCBI: |
872346 |
| UniProt: |
Q5JSJ4 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: ASTEPEQLGSVPTDESAITQMCEVTGGRSYCVRTQRMLNQCLESLVQKVQ |
| Target: |
INTS6L |
![]()
|
WB Suggested Anti-DDX26B Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: THP-1 cell lysate. |
