DNA2L Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324652
| Article Name: |
DNA2L Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324652 |
| Supplier Catalog Number: |
orb324652 |
| Alternative Catalog Number: |
BYT-ORB324652-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human DNA2L |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti DNA2L antibody, anti FLJ10063 antibody, anti KIAA0083 antibody, anti MGC133297 antibody |
| Rabbit polyclonal antibody to DNA2 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
54kDa |
| NCBI: |
53574 |
| UniProt: |
P51530 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: KLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGGVSNVTE |
| Target: |
DNA2 |
![]()
|
WB Suggested Anti-DNA2L Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human heart. |
