Prrxl1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324661
Article Name: Prrxl1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324661
Supplier Catalog Number: orb324661
Alternative Catalog Number: BYT-ORB324661-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Rat
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Prrxl1
Conjugation: Unconjugated
Alternative Names: anti Drg11 antibody, anti Drgx antibody, anti Prrxl1 antibody
Rabbit polyclonal antibody to Drgx
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 28kDa
NCBI: 665710
UniProt: Q62798
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GAKEPMAEVTPPPVRNINSPPPGDQARGKKEALEAQQSLGRTVGPAGPFF
Target: Drgx
Sample Type: Rat Pancreas lysates, Antibody Dilution: 1.0 ug/mL.