Tal2 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324672
Article Name: Tal2 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324672
Supplier Catalog Number: orb324672
Alternative Catalog Number: BYT-ORB324672-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: Unconjugated
Alternative Names: anti MGC130117 antibody, anti bHLHa19 antibody
Rabbit polyclonal antibody to Tal2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 12kDa
NCBI: 033343
UniProt: Q62282
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: INFLVKVLGEQSLHQTGVAAQGNILGLFPPKTRLPDEDDRTLLNDYRVPS
Target: Tal2
WB Suggested Anti-Tal2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Small Intestine.