Sfpi1 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: Sfpi1 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324681
• Supplier Catalog Number: orb324681
• Alternative Catalog Number: BYT-ORB324681-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Sfpi1
• Conjugation: Unconjugated
• Alternative Names: anti Dis-1 antibody, anti Dis1 antibody, anti PU.1 antibody, anti Sfpi-1 antibody, anti Spi-1 antibody, anti Spi1 antibody, anti Tcfpu1 antibody, anti Tfpu.1 antibody, anti Sfpi1 antibody

Product Description

Rabbit polyclonal antibody to Spi1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 31kDa
• NCBI: 035485
• UniProt: P17433
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MLQACKMEGFSLTAPPSDDLVTYDSELYQRPMHDYYSFVGSDGESHSDHY
• Target: Spi1

Images

Sample Type: Mouse Testis lysates, Antibody Dilution: 1.0 ug/mL.