Cited4 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324684
| Article Name: |
Cited4 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324684 |
| Supplier Catalog Number: |
orb324684 |
| Alternative Catalog Number: |
BYT-ORB324684-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti AU019445 antibody, anti AW742964 antibody, anti Mrg2 antibody, anti MRG-2 antibody |
| Rabbit polyclonal antibody to Cited4 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
18kDa |
| NCBI: |
062509 |
| UniProt: |
Q9WUL8 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: PPPPGTLAYGSFGSPVSFQPFPVSQSPGAGSTHLQSAATPSPGRIPAPPA |
| Target: |
Cited4 |
![]()
|
WB Suggested Anti-Cited4 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Heart. |
