Zfp444 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324695
| Article Name: |
Zfp444 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324695 |
| Supplier Catalog Number: |
orb324695 |
| Alternative Catalog Number: |
BYT-ORB324695-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti 2810031J10Rik antibody, anti 6230401O10Rik antibody, anti FLJ00134 antibody, anti mFLJ00134 antibody |
| Rabbit polyclonal antibody to Zfp444 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
36kDa |
| NCBI: |
082592 |
| UniProt: |
Q3TDV8 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: PFACWECGKGFGRREHVLRHQRIHGRAAAVAQGTSAPGPEGGGAFPPWAL |
| Target: |
Zfp444 |
![]()
|
WB Suggested Anti-Zfp444 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Muscle. |
