Jundm2 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324697
Article Name: Jundm2 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324697
Supplier Catalog Number: orb324697
Alternative Catalog Number: BYT-ORB324697-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of mouse Jundm2
Conjugation: Unconjugated
Alternative Names: anti Jdp2 antibody, anti Jundp2 antibody, anti TIF antibody, anti Jundm2 antibody
Rabbit polyclonal antibody to Jdp2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 19kDa
NCBI: 112149
UniProt: P97875
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPL
Target: Jdp2
WB Suggested Anti-Jundm2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Heart.