CBFA2T2H Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324713
| Article Name: |
CBFA2T2H Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324713 |
| Supplier Catalog Number: |
orb324713 |
| Alternative Catalog Number: |
BYT-ORB324713-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse CBFA2T2H |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti MTGR1 antibody, anti Cbfa2t2h antibody, anti A430091M07 antibody, anti C330013D05Rik antibody |
| Rabbit polyclonal antibody to Cbfa2t2 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
65kDa |
| NCBI: |
766448 |
| UniProt: |
Q6P288 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: RRSMAVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDS |
| Target: |
Cbfa2t2 |
![]()
|
WB Suggested Anti-CBFA2T2H Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: NIH/3T3 cell lysate. |
