B230358A15Rik Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324714
| Article Name: |
B230358A15Rik Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324714 |
| Supplier Catalog Number: |
orb324714 |
| Alternative Catalog Number: |
BYT-ORB324714-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti HSF 3 antibody, anti mHSF3 antibody, anti HSTF 3 antibody, anti B230358A15Rik antibody, anti RP23-348N10.1 antibody |
| Rabbit polyclonal antibody to Hsf3 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
36kDa |
| NCBI: |
766519 |
| UniProt: |
Q8BL67 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: EDKYKSLLDRVMPILKESKKLISSGDQPSGDDGEHPKVPVQDKPMNEESL |
| Target: |
Hsf3 |
![]()
|
WB Suggested Anti-B230358A15Rik Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Mouse liver. |
