Zfp445 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324716
| Article Name: |
Zfp445 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324716 |
| Supplier Catalog Number: |
orb324716 |
| Alternative Catalog Number: |
BYT-ORB324716-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti AW610627 antibody, anti ZNF168 antibody, anti mszf29 antibody, anti mszf50 antibody, anti Znf445 antibody |
| Rabbit polyclonal antibody to Zfp445 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
115kDa |
| NCBI: |
775540 |
| UniProt: |
Q8R2V3 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: KLHHKEVYKQEKRQEDFKQSYRQSQVISTVEKTFPCQNCGKTFTQKKSLI |
| Target: |
Zfp445 |
![]()
|
WB Suggested Anti-Zfp445 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Brain. |
