A830053O21Rik Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324720
| Article Name: |
A830053O21Rik Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324720 |
| Supplier Catalog Number: |
orb324720 |
| Alternative Catalog Number: |
BYT-ORB324720-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse A830053O21Rik |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti A830053O21Rik antibody, anti RP23-343C18.1 antibody |
| Rabbit polyclonal antibody to Bhlha9 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
18kDa |
| NCBI: |
796156 |
| UniProt: |
Q5RJB0 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: RKRERPTRSKARRMAANVRERKRILDYNEAFNALRRALQHDLGGKRLSKI |
| Target: |
Bhlha9 |
![]()
|
WB Suggested Anti-A830053O21Rik Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Brain. |
