Tmem130 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324722
Article Name: Tmem130 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324722
Supplier Catalog Number: orb324722
Alternative Catalog Number: BYT-ORB324722-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: Unconjugated
Alternative Names: anti BC067004 antibody, anti C130036G08 antibody, anti MGC157450 antibody, anti MGC157451 antibody
Rabbit polyclonal antibody to Tmem130
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 46kDa
NCBI: 808403
UniProt: Q6NXM3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: FTVKVRVVAEWEQIKPDTTKGTIQKTGDFSASLDLRESLQGIQILGPTLL
Target: Tmem130
WB Suggested Anti-Tmem130 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Thymus.