Prrxl1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324744
Article Name: Prrxl1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324744
Supplier Catalog Number: orb324744
Alternative Catalog Number: BYT-ORB324744-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: Unconjugated
Alternative Names: anti Drg11 antibody, anti Drgx antibody
Rabbit polyclonal antibody to Prrxl1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 25kDa
NCBI: 001001796
UniProt: Q8BYH0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: PSCLPGTLLNTATYAQALSHVASLKDHFRAMLCSGSFGFRGEQTQQRALT
Target: Prrxl1
WB Suggested Anti-Prrxl1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Mouse Liver.