KIAA0040 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324779
Article Name: KIAA0040 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324779
Supplier Catalog Number: orb324779
Alternative Catalog Number: BYT-ORB324779-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0040
Conjugation: Unconjugated
Alternative Names: anti MGC133301 antibody
Rabbit polyclonal antibody to KIAA0040
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 17kDa
NCBI: 055471
UniProt: Q15053
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: DPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDGRTIDRFSP
Target: KIAA0040
WB Suggested Anti-KIAA0040 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.