ZSCAN12 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324780
| Article Name: |
ZSCAN12 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324780 |
| Supplier Catalog Number: |
orb324780 |
| Alternative Catalog Number: |
BYT-ORB324780-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZSC12 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti ZSCAN12 antibody, anti KIAA0426 antibody, anti ZNF305 antibody, anti ZNF96 antibody, anti antibody |
| Rabbit polyclonal antibody to ZSC12 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
66kDa |
| NCBI: |
055539 |
| UniProt: |
O43309 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: LEVKIEEEKYTTRQDWDLRKNNTHSREVFRQYFRQFCYQETSGPREALSR |
| Target: |
ZSCAN12 |
![]()
|
Sample Type: RPMI-8226 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL. |
