RTRAF Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324787
| Article Name: |
RTRAF Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324787 |
| Supplier Catalog Number: |
orb324787 |
| Alternative Catalog Number: |
BYT-ORB324787-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Conjugation: |
Unconjugated |
| Alternative Names: |
2700060E02Rik |
| Rabbit polyclonal antibody to 2700060E02Rik |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
28kDa |
| NCBI: |
080804 |
| UniProt: |
Q9CQE8 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: EKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADP |
| Target: |
RTRAF |
![]()
|
WB Suggested Anti-2700060E02Rik Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Liver. |
