TCEAL9 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324788
Article Name: TCEAL9 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324788
Supplier Catalog Number: orb324788
Alternative Catalog Number: BYT-ORB324788-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WBP5
Conjugation: Unconjugated
Alternative Names: anti DKFZp313K1940 antibody, anti TCEAL9 antibody
Rabbit polyclonal antibody to WBP5
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 13kDa
NCBI: 057387
UniProt: Q9UHQ7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: TFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWK
Target: TCEAL9
WB Suggested Anti-WBP5 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: THP-1 cell lysate.